PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010095247.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family G2-like
Protein Properties Length: 256aa    MW: 29063.8 Da    PI: 6.8014
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010095247.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.21.4e-311266155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    k+rlrWt+eLH+rFveav++LGG++ AtPk il++m+++gLt+ hvkSHLQkYR+
  XP_010095247.1 12 KERLRWTQELHDRFVEAVTRLGGPDMATPKGILKAMSIPGLTIFHVKSHLQKYRI 66
                    68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.7E-171166IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-281267IPR009057Homeodomain-like
TIGRFAMsTIGR015576.3E-251266IPR006447Myb domain, plants
PfamPF002492.3E-81465IPR001005SANT/Myb domain
PfamPF143793.5E-1698138IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MGWSGSDHGC GKERLRWTQE LHDRFVEAVT RLGGPDMATP KGILKAMSIP GLTIFHVKSH  60
LQKYRIANFI PESNSRGKFE KKNMSEILPN FSTTSAAQLE EALEMQMEVQ RQLNDQLEMQ  120
KSLKQKMEAQ GRYLQRITKG KHTNIKKASS TNIPSKSNGS LISMPSLSED NSESKLPKEC  180
ESDSEADKTE IEYHEEGTFQ APKRLRVKDG DTLSPRLNPA PLDSVSEFYG QSYMFQPEDD  240
TNFQYWIQSL PLPSFL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010095247.10.0Myb family transcription factor APL
TrEMBLW9R6J90.0W9R6J9_9R
STRINGVIT_08s0105g00370.t011e-76(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF106592535
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.12e-50G2-like family protein